PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g010190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 324aa    MW: 35993 Da    PI: 7.8348
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g010190.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
   Csa06g010190.1 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.26e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   Csa06g010190.1  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.078961IPR017930Myb domain
SuperFamilySSF466891.87E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002495.6E-161461IPR001005SANT/Myb domain
CDDcd001679.65E-111661No hitNo description
PROSITE profilePS5129423.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1467112IPR001005SANT/Myb domain
CDDcd001672.79E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKVN  120
QDSHLELDRS SLSSSPSSSS ANSNSNISRG QWERRLQTDI HLAKKALSEA LSPAVAPIIT  180
STVTTTSSAE SRRSTSSASG FLRTQETSTT YASSTENIAK LLKGWVKNSP KTHNSADQIT  240
CTDSEVKEGI KSDDVKDCTG ALQSFSEFDH SYQHAGVSPD HETKQDITGC SNQSQWSLFE  300
KWLFEDSGGQ IGDILLDENT NFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-251411627128MYB TRANSFORMING PROTEIN
1mse_C2e-25141164105C-Myb DNA-Binding Domain
1msf_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2503390.0AF250339.1 Arabidopsis thaliana Myb30 (Myb30) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010514606.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU70.0MYB30_ARATH; Transcription factor MYB30
TrEMBLD7LM570.0D7LM57_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.5__652__AT3G28910.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.10.0myb domain protein 30